"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4JFD2"	"{'domain_architectures': 4324, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pirsf': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4324}"	"['Component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs)', 'Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks']"	"Dgri\GH19295"	"[{'identifier': 'GO:0034314', 'name': 'Arp2/3 complex-mediated actin nucleation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005856', 'name': 'cytoskeleton', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005885', 'name': 'Arp2/3 protein complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"B4JFD2_DROGR"	"d1017cf1b80e248e2fdb9c261faafb37841a752a"	True	False	False	177	"Actin-related protein 2/3 complex subunit 3"	3	"UP000001070"	"MPAYHSQIKDFRQQVGNMAILPLRTQVRGPAPSANVDSDIIDESLYFFKANVFFRTYEVKSEVDRVLIYITLYITECLKRLTRITSKAQGQQEMYSLAISKFDIPGDAGFPLNSVYAKPQTAQDADLMRQYLLQLRHETGNRVVEKVFSTEDGRPNKWWTCFAKKKFMEKSLAGPGQ"	"unreviewed"	"{'taxId': '7222', 'scientificName': 'Drosophila grimshawi', 'fullName': 'Drosophila grimshawi (Hawaiian fruit fly)'}"