General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8CEM1",
        "id": "ASIP_MACCY",
        "source_organism": {
            "taxId": "78449",
            "scientificName": "Macaca cyclopis",
            "fullName": "Macaca cyclopis (Taiwan macaque)"
        },
        "name": "Agouti-signaling protein",
        "description": [
            "Signaling protein that functions as an antagonist of melanocyte-stimulating-hormone receptor MC1R, thereby playing a role in the regulation of melanogenesis (By similarity). Binding to MC1R prevents alpha-MSH-induced signaling and inhibits cAMP production, resulting in down-regulation of eumelanogenesis (brown/black pigment) and increased pheomelanin (yellow/red pigment) synthesis (By similarity)"
        ],
        "length": 132,
        "sequence": "MDVTRLLLATLLVFLCFFTAYSHPPPEEKLRDDRSLRSNSSVNLLDFPSVSIMALNKNSKQISRKEAEKKRSSKKEASMKKVARPRTPLSAPCVATRDSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC",
        "proteome": null,
        "gene": "ASIP",
        "go_terms": [
            {
                "identifier": "GO:0009755",
                "name": "hormone-mediated signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005102",
                "name": "signaling receptor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ea075f60af0c34057757a25b6b71a073b05f4e4e",
        "counters": {
            "domain_architectures": 2026,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "profile": 1,
                "ssf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2026
        }
    }
}