"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A8CEM1"	"{'domain_architectures': 2026, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cathgene3d': 1, 'pfam': 1, 'profile': 1, 'ssf': 1, 'panther': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2026}"	"['Signaling protein that functions as an antagonist of melanocyte-stimulating-hormone receptor MC1R, thereby playing a role in the regulation of melanogenesis (By similarity). Binding to MC1R prevents alpha-MSH-induced signaling and inhibits cAMP production, resulting in down-regulation of eumelanogenesis (brown/black pigment) and increased pheomelanin (yellow/red pigment) synthesis (By similarity)']"	"ASIP"	"[{'identifier': 'GO:0009755', 'name': 'hormone-mediated signaling pathway', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005102', 'name': 'signaling receptor binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"ASIP_MACCY"	"ea075f60af0c34057757a25b6b71a073b05f4e4e"	True	False	False	132	"Agouti-signaling protein"	3	""	"MDVTRLLLATLLVFLCFFTAYSHPPPEEKLRDDRSLRSNSSVNLLDFPSVSIMALNKNSKQISRKEAEKKRSSKKEASMKKVARPRTPLSAPCVATRDSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC"	"reviewed"	"{'taxId': '78449', 'scientificName': 'Macaca cyclopis', 'fullName': 'Macaca cyclopis (Taiwan macaque)'}"