HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A7F5M4",
"id": "LSM6_SCLS1",
"source_organism": {
"taxId": "665079",
"scientificName": "Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)",
"fullName": "Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold)"
},
"name": "U6 snRNA-associated Sm-like protein LSm6",
"description": [
"Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway. Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 di-snRNP, spliceosomal U4/U6.U5 tri-snRNP, and free U6 snRNP). It binds directly to the 3'-terminal U-tract of U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. LSM2-LSM8 probably also is involved degradation of nuclear pre-mRNA by targeting them for decapping, and in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA (By similarity)"
],
"length": 85,
"sequence": "MENGALNQGEGKDPSSFLSDIIGSRVIVKLNNSLVFKGELQSVDGYMNIALEKCEEWVHGKKKTVHGDAFVRGNNVMYISADDSA",
"proteome": "UP000001312",
"gene": "lsm6",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000398",
"name": "mRNA splicing, via spliceosome",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "83b18cf71a575d59c0de6840812ffe7912383fc4",
"counters": {
"domain_architectures": 70645,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"profile": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 70645
}
}
}