"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A7F5M4"	"{'domain_architectures': 70645, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'profile': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'pirsf': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 70645}"	"[""Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway. Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 di-snRNP, spliceosomal U4/U6.U5 tri-snRNP, and free U6 snRNP). It binds directly to the 3'-terminal U-tract of U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. LSM2-LSM8 probably also is involved degradation of nuclear pre-mRNA by targeting them for decapping, and in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA (By similarity)""]"	"lsm6"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000398', 'name': 'mRNA splicing, via spliceosome', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"LSM6_SCLS1"	"83b18cf71a575d59c0de6840812ffe7912383fc4"	True	False	False	85	"U6 snRNA-associated Sm-like protein LSm6"	3	"UP000001312"	"MENGALNQGEGKDPSSFLSDIIGSRVIVKLNNSLVFKGELQSVDGYMNIALEKCEEWVHGKKKTVHGDAFVRGNNVMYISADDSA"	"reviewed"	"{'taxId': '665079', 'scientificName': 'Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)', 'fullName': 'Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold)'}"
