General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A5HUP6",
        "id": "GSG7_ANOST",
        "source_organism": {
            "taxId": "30069",
            "scientificName": "Anopheles stephensi",
            "fullName": "Anopheles stephensi (Indo-Pakistan malaria mosquito)"
        },
        "name": "gSG7 salivary protein",
        "description": [
            "Salivary protein with anticoagulant activity (PubMed:17456441). Inhibits activation of host kallikrein-kinin system by preventing the reciprocal activation of coagulation factor XII (F12) and prekallikrein (KLKB1), and subsequent release of bradykinin (PubMed:17456441). Inhibits host factor XII and high molecular weight kininogen (KNG1) binding to negatively charged surfaces (PubMed:17456441). Weakly inhibits the alternative pathway of complement system activation in the host (PubMed:33199367)"
        ],
        "length": 142,
        "sequence": "METKLVLALIACGVICLLQTTPTEATGKHVQQLMKVFRAIDFDFTKKAFYLHRAKYGVQNQLRNPLYLKAMSLPRSAKLSQPCLKKMIDEVNDLESTFYAGFSFNCHDHDQYSMDCLEAAEPTYLDGLKKLAASTEQCLVQK",
        "proteome": "UP000076408",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "744d2eaf7533c831fd29777deb5e3599fdac4b0b",
        "counters": {
            "domain_architectures": 239,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 239
        }
    }
}