"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A5HUP6"	"{'domain_architectures': 239, 'entries': 2, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 1, 'taxa': 1, 'dbEntries': {'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 239}"	"['Salivary protein with anticoagulant activity (PubMed:17456441). Inhibits activation of host kallikrein-kinin system by preventing the reciprocal activation of coagulation factor XII (F12) and prekallikrein (KLKB1), and subsequent release of bradykinin (PubMed:17456441). Inhibits host factor XII and high molecular weight kininogen (KNG1) binding to negatively charged surfaces (PubMed:17456441). Weakly inhibits the alternative pathway of complement system activation in the host (PubMed:33199367)']"	""	""	"GSG7_ANOST"	"744d2eaf7533c831fd29777deb5e3599fdac4b0b"	True	False	False	142	"gSG7 salivary protein"	1	"UP000076408"	"METKLVLALIACGVICLLQTTPTEATGKHVQQLMKVFRAIDFDFTKKAFYLHRAKYGVQNQLRNPLYLKAMSLPRSAKLSQPCLKKMIDEVNDLESTFYAGFSFNCHDHDQYSMDCLEAAEPTYLDGLKKLAASTEQCLVQK"	"reviewed"	"{'taxId': '30069', 'scientificName': 'Anopheles stephensi', 'fullName': 'Anopheles stephensi (Indo-Pakistan malaria mosquito)'}"