General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AAD2YUS5",
        "id": "A0AAD2YUS5_ECOLX",
        "source_organism": {
            "taxId": "1055536",
            "scientificName": "Escherichia coli O103",
            "fullName": "Escherichia coli O103"
        },
        "name": "5-formyltetrahydrofolate cyclo-ligase",
        "description": [
            "Involved in the removal of 5-formyltetrahydrofolate. In vitro, it is a potent inhibitor of various folate-dependent enzymes in the C1 metabolism network and in vivo it might function as a folate storage. 5-formyltetrahydrofolate is also used as an antifolate rescue agent in cancer chemotherapy. Catalyzes the irreversible ATP-dependent transformation of 5-formyltetrahydrofolate (5-CHO-THF) to form 5,10-methenyltetrahydrofolate (5,10-CH=THF). The reverse reaction is catalyzed by the serine hydroxymethyltransferase GlyA (SHMT)"
        ],
        "length": 200,
        "sequence": "MTQLPELPLTLSRQEIRKMIRQRRRALTPEQQQEMGQQAATRMMTYPPVVMAHTVAVFLSFDGELDTQPLIEQLWRAGKRVYLPVLHPFSAGNLLFLNYHPQSELVMNRLKIHEPKLDVRDVLPLSRLDVLITPLVAFDEYGQRLGMGGGFYDRTLQNWQHYKTQPVGYAHDCQLVEKLPVEEWDIPLPAVVTPSKVWEW",
        "proteome": null,
        "gene": "QF322_003327",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "da7902c2269b39b3671d00300f68342993ce3964",
        "counters": {
            "domain_architectures": 33030,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 33030
        }
    }
}