"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AAD2YUS5"	"{'domain_architectures': 33030, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'ncbifam': 2, 'pirsf': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 33030}"	"['Involved in the removal of 5-formyltetrahydrofolate. In vitro, it is a potent inhibitor of various folate-dependent enzymes in the C1 metabolism network and in vivo it might function as a folate storage. 5-formyltetrahydrofolate is also used as an antifolate rescue agent in cancer chemotherapy. Catalyzes the irreversible ATP-dependent transformation of 5-formyltetrahydrofolate (5-CHO-THF) to form 5,10-methenyltetrahydrofolate (5,10-CH=THF). The reverse reaction is catalyzed by the serine hydroxymethyltransferase GlyA (SHMT)']"	"QF322_003327"	""	"A0AAD2YUS5_ECOLX"	"da7902c2269b39b3671d00300f68342993ce3964"	True	False	False	200	"5-formyltetrahydrofolate cyclo-ligase"	3	""	"MTQLPELPLTLSRQEIRKMIRQRRRALTPEQQQEMGQQAATRMMTYPPVVMAHTVAVFLSFDGELDTQPLIEQLWRAGKRVYLPVLHPFSAGNLLFLNYHPQSELVMNRLKIHEPKLDVRDVLPLSRLDVLITPLVAFDEYGQRLGMGGGFYDRTLQNWQHYKTQPVGYAHDCQLVEKLPVEEWDIPLPAVVTPSKVWEW"	"unreviewed"	"{'taxId': '1055536', 'scientificName': 'Escherichia coli O103', 'fullName': 'Escherichia coli O103'}"