General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A9F2QWW3",
        "id": "A0A9F2QWW3_PYTBI",
        "source_organism": {
            "taxId": "176946",
            "scientificName": "Python bivittatus",
            "fullName": "Python bivittatus (Burmese python)"
        },
        "name": "DNA excision repair protein ERCC-8",
        "description": [
            "Substrate-recognition component of the CSA complex, a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex, involved in transcription-coupled nucleotide excision repair (TC-NER), a process during which RNA polymerase II-blocking lesions are rapidly removed from the transcribed strand of active genes. Following recruitment to lesion-stalled RNA polymerase II (Pol II), the CSA complex mediates ubiquitination of Pol II subunit POLR2A/RPB1 at 'Lys-1268', a critical TC-NER checkpoint, governing RNA Pol II stability and initiating DNA damage excision by TFIIH recruitment. The CSA complex also promotes the ubiquitination and subsequent proteasomal degradation of ERCC6/CSB in a UV-dependent manner; ERCC6 degradation is essential for the recovery of RNA synthesis after transcription-coupled repair. Also plays a role in DNA double-strand breaks (DSSBs) repair by non-homologous end joining (NHEJ)"
        ],
        "length": 343,
        "sequence": "MLSGGSDGAIVLYDLENFSRKPCYTCKAICSVRRNHPGVHKFSVETVQWYPHDTGMFTSSSFDKTLKIWDTNTLQPADVFHFDGTVYSHHMSPVATRHCLIAVGTKSPKVQLCDFKSGSCSHILQGHTQEVLAVSWSPRYEFILATGSADSRVKLWDVRRASACLITLDQHNGEKSKAASETINTAHNGRVNGLCFTSDGLHLLTAGTDDRMRLWNSSSGENTLVNYGKVSNESKKGLRFTVSHGCSSEFAFVPCSTTVAVYTIYSGDLITTLRGHYSSVDCCVFQPNFQELYSSGRDGNILAWVPYLREPEPDDTHSEKLLSKQCLNPAYEDAWSSSDDEVG",
        "proteome": "UP000695026",
        "gene": "ERCC8",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006283",
                "name": "transcription-coupled nucleotide-excision repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "384db74b5b94cd1cee33dedf16c3064646a93d11",
        "counters": {
            "domain_architectures": 50367,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "profile": 2,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 50367
        }
    }
}