"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A9F2QWW3"	"{'domain_architectures': 50367, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'profile': 2, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 50367}"	"[""Substrate-recognition component of the CSA complex, a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex, involved in transcription-coupled nucleotide excision repair (TC-NER), a process during which RNA polymerase II-blocking lesions are rapidly removed from the transcribed strand of active genes. Following recruitment to lesion-stalled RNA polymerase II (Pol II), the CSA complex mediates ubiquitination of Pol II subunit POLR2A/RPB1 at 'Lys-1268', a critical TC-NER checkpoint, governing RNA Pol II stability and initiating DNA damage excision by TFIIH recruitment. The CSA complex also promotes the ubiquitination and subsequent proteasomal degradation of ERCC6/CSB in a UV-dependent manner; ERCC6 degradation is essential for the recovery of RNA synthesis after transcription-coupled repair. Also plays a role in DNA double-strand breaks (DSSBs) repair by non-homologous end joining (NHEJ)""]"	"ERCC8"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006283', 'name': 'transcription-coupled nucleotide-excision repair', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A9F2QWW3_PYTBI"	"384db74b5b94cd1cee33dedf16c3064646a93d11"	True	False	False	343	"DNA excision repair protein ERCC-8"	4	"UP000695026"	"MLSGGSDGAIVLYDLENFSRKPCYTCKAICSVRRNHPGVHKFSVETVQWYPHDTGMFTSSSFDKTLKIWDTNTLQPADVFHFDGTVYSHHMSPVATRHCLIAVGTKSPKVQLCDFKSGSCSHILQGHTQEVLAVSWSPRYEFILATGSADSRVKLWDVRRASACLITLDQHNGEKSKAASETINTAHNGRVNGLCFTSDGLHLLTAGTDDRMRLWNSSSGENTLVNYGKVSNESKKGLRFTVSHGCSSEFAFVPCSTTVAVYTIYSGDLITTLRGHYSSVDCCVFQPNFQELYSSGRDGNILAWVPYLREPEPDDTHSEKLLSKQCLNPAYEDAWSSSDDEVG"	"unreviewed"	"{'taxId': '176946', 'scientificName': 'Python bivittatus', 'fullName': 'Python bivittatus (Burmese python)'}"