General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8M1GSW6",
        "id": "A0A8M1GSW6_URSMA",
        "source_organism": {
            "taxId": "29073",
            "scientificName": "Ursus maritimus",
            "fullName": "Ursus maritimus (Polar bear)"
        },
        "name": "Mediator of RNA polymerase II transcription subunit 21",
        "description": [
            "Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors"
        ],
        "length": 74,
        "sequence": "MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEVISFFRICPAFCSTDCTNSKRH",
        "proteome": "UP000261680",
        "gene": "MED21",
        "go_terms": [
            {
                "identifier": "GO:0016592",
                "name": "mediator complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f7a07e05ddf412899bc3cb8db294ca05ac54bbeb",
        "counters": {
            "domain_architectures": 4627,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4627
        }
    }
}