"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8M1GSW6"	"{'domain_architectures': 3506, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3506}"	"['Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors']"	"MED21"	"[{'identifier': 'GO:0016592', 'name': 'mediator complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A8M1GSW6_URSMA"	"f7a07e05ddf412899bc3cb8db294ca05ac54bbeb"	True	False	74	"Mediator of RNA polymerase II transcription subunit 21"	3	"UP000261680"	"MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEVISFFRICPAFCSTDCTNSKRH"	"unreviewed"	"{'taxId': '29073', 'scientificName': 'Ursus maritimus', 'fullName': 'Ursus maritimus (Polar bear)'}"