GET /api/protein/UniProt/A0A7J8JGI6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J8JGI6",
"id": "A0A7J8JGI6_ROUAE",
"source_organism": {
"taxId": "9407",
"scientificName": "Rousettus aegyptiacus",
"fullName": "Rousettus aegyptiacus (Egyptian fruit bat)"
},
"name": "Transcription cofactor HES-6",
"description": [
"Does not bind DNA itself but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. Also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCF3/E47, allowing ASCL1 and TCF3 to up-regulate transcription in its presence. Promotes cell differentiation"
],
"length": 113,
"sequence": "MAPLLASGRLRAGREDEDRGWEARGDRKARKPLVEKKRRARINESLHELRLLLAGPEVQAKLENAEVLELTGANSYRRKRASASPLATSNACMRCTRSCPRARPSTPPSPPSS",
"proteome": "UP000593571",
"gene": "HJG63_006225",
"go_terms": [
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "15b86a07eaabcbc71b6ebb705399c8a22c21f484",
"counters": {
"domain_architectures": 146351,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 146351
}
}
}