"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7J8JGI6"	"{'domain_architectures': 133055, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 133055}"	"['Does not bind DNA itself but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. Also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCF3/E47, allowing ASCL1 and TCF3 to up-regulate transcription in its presence. Promotes cell differentiation']"	"HJG63_006225"	"[{'identifier': 'GO:0046983', 'name': 'protein dimerization activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A7J8JGI6_ROUAE"	"15b86a07eaabcbc71b6ebb705399c8a22c21f484"	True	False	113	"Transcription cofactor HES-6"	4	"UP000593571"	"MAPLLASGRLRAGREDEDRGWEARGDRKARKPLVEKKRRARINESLHELRLLLAGPEVQAKLENAEVLELTGANSYRRKRASASPLATSNACMRCTRSCPRARPSTPPSPPSS"	"unreviewed"	"{'taxId': '9407', 'scientificName': 'Rousettus aegyptiacus', 'fullName': 'Rousettus aegyptiacus (Egyptian fruit bat)'}"