General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7YLU9",
        "id": "A0A6P7YLU9_9AMPH",
        "source_organism": {
            "taxId": "1415580",
            "scientificName": "Microcaecilia unicolor",
            "fullName": "Microcaecilia unicolor"
        },
        "name": "PRKCA-binding protein",
        "description": [
            "Probable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor internalization level. Plays a role in synaptic plasticity by regulating the trafficking and internalization of AMPA receptors. May be regulated upon PRKCA activation. May regulate ASIC1/ASIC3 channel. Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competitive with nucleation promoting factors and is linked to neuronal morphology regulation and AMPA receptor (AMPAR) endocytosis. Via interaction with the Arp2/3 complex involved in regulation of synaptic plasicity of excitatory synapses and required for spine shrinkage during long-term depression (LTD). Involved in regulation of astrocyte morphology, antagonistic to Arp2/3 complex activator WASL/N-WASP function"
        ],
        "length": 398,
        "sequence": "MFADPDFDIEEDKLGIPTVPGTVTLKKDTQNLIGISIGGGAQYCPCLYIVQVFDNTPAAIDGTLAAGDEITGVNGKSVKGKTKVEVAKMIQNVKAEVTIHYNKLQADPKQGKSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMMEHTKRLLRSFYELSQTHRGFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLNDLNTYLNKAIPDTKLTIRKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARSRFAKMRKDVLEKVELLDQKHVQDIVFQLQRFVSTMSKYYDDCYAVLKDADVFPIEVDLARTTLSYGQKDIFTEGAEEEEDVEENEEKLIDDA",
        "proteome": "UP000515156",
        "gene": "PICK1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019904",
                "name": "protein domain specific binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "61e91bb4dcfbaa5c15d4460ae7510ed875005d57",
        "counters": {
            "domain_architectures": 1960,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 2,
                "pfam": 2,
                "profile": 2,
                "smart": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1960
        }
    }
}