"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P7YLU9"	"{'domain_architectures': 1773, 'entries': 19, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'cdd': 2, 'pfam': 2, 'profile': 2, 'smart': 2, 'panther': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1773}"	"['Probable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor internalization level. Plays a role in synaptic plasticity by regulating the trafficking and internalization of AMPA receptors. May be regulated upon PRKCA activation. May regulate ASIC1/ASIC3 channel. Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competitive with nucleation promoting factors and is linked to neuronal morphology regulation and AMPA receptor (AMPAR) endocytosis. Via interaction with the Arp2/3 complex involved in regulation of synaptic plasicity of excitatory synapses and required for spine shrinkage during long-term depression (LTD). Involved in regulation of astrocyte morphology, antagonistic to Arp2/3 complex activator WASL/N-WASP function']"	"PICK1"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019904', 'name': 'protein domain specific binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A6P7YLU9_9AMPH"	"61e91bb4dcfbaa5c15d4460ae7510ed875005d57"	True	False	398	"PRKCA-binding protein"	4	"UP000515156"	"MFADPDFDIEEDKLGIPTVPGTVTLKKDTQNLIGISIGGGAQYCPCLYIVQVFDNTPAAIDGTLAAGDEITGVNGKSVKGKTKVEVAKMIQNVKAEVTIHYNKLQADPKQGKSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMMEHTKRLLRSFYELSQTHRGFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLNDLNTYLNKAIPDTKLTIRKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARSRFAKMRKDVLEKVELLDQKHVQDIVFQLQRFVSTMSKYYDDCYAVLKDADVFPIEVDLARTTLSYGQKDIFTEGAEEEEDVEENEEKLIDDA"	"unreviewed"	"{'taxId': '1415580', 'scientificName': 'Microcaecilia unicolor', 'fullName': 'Microcaecilia unicolor'}"