GET /api/protein/UniProt/A0A6P7I6P7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7I6P7",
        "id": "A0A6P7I6P7_9TELE",
        "source_organism": {
            "taxId": "210632",
            "scientificName": "Parambassis ranga",
            "fullName": "Parambassis ranga (Indian glassy fish)"
        },
        "name": "Endonuclease V",
        "description": [
            "Endoribonuclease that specifically cleaves inosine-containing RNAs: cleaves RNA at the second phosphodiester bond 3' to inosine. Active against both single-stranded and double-stranded RNAs. Has strong preference for single-stranded RNAs (ssRNAs) toward double-stranded RNAs (dsRNAs). Cleaves mRNAs and tRNAs containing inosine. Also able to cleave structure-specific dsRNA substrates containing the specific sites 5'-IIUI-3' and 5'-UIUU-3'. Inosine is present in a number of RNAs following editing; the function of inosine-specific endoribonuclease is still unclear: it could either play a regulatory role in edited RNAs, or be involved in antiviral response by removing the hyperedited long viral dsRNA genome that has undergone A-to-I editing. Binds branched DNA structures"
        ],
        "length": 256,
        "sequence": "MSAPPAEDLLEEWKSEQERLRQQVVEVDTEDWQRKPDFSGLQRVGGMDLSFIKGDDFNACAQLVVLSYPDLKLLYEDSQMVTLTAPYVAGFLAFRETPFLLEALQRLRMKQPNLLPQVVFVDGNGLFHYREFGLACHLGVLSGLPCVGVAKNLLQVQGVHKSEEHQAQIAALQKGGDSFPLTAASGKVLGKALRSSDSSSKPVYVSVGHRISLDTAVRLTHSCCRYRVPEPIRQADCRSREYLRKHFPAADACTKE",
        "proteome": "UP000515145",
        "gene": "endov",
        "go_terms": [
            {
                "identifier": "GO:0004519",
                "name": "endonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b5a39602cf38e8ce3ece3fd23a0477f612e3b1c6",
        "counters": {
            "domain_architectures": 9514,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9514
        }
    }
}