"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P7I6P7"	"{'domain_architectures': 7237, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7237}"	"[""Endoribonuclease that specifically cleaves inosine-containing RNAs: cleaves RNA at the second phosphodiester bond 3' to inosine. Active against both single-stranded and double-stranded RNAs. Has strong preference for single-stranded RNAs (ssRNAs) toward double-stranded RNAs (dsRNAs). Cleaves mRNAs and tRNAs containing inosine. Also able to cleave structure-specific dsRNA substrates containing the specific sites 5'-IIUI-3' and 5'-UIUU-3'. Inosine is present in a number of RNAs following editing; the function of inosine-specific endoribonuclease is still unclear: it could either play a regulatory role in edited RNAs, or be involved in antiviral response by removing the hyperedited long viral dsRNA genome that has undergone A-to-I editing. Binds branched DNA structures""]"	"LOC114437263"	"[{'identifier': 'GO:0004519', 'name': 'endonuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A6P7I6P7_9TELE"	"b5a39602cf38e8ce3ece3fd23a0477f612e3b1c6"	True	False	256	"Endonuclease V"	3	"UP000515145"	"MSAPPAEDLLEEWKSEQERLRQQVVEVDTEDWQRKPDFSGLQRVGGMDLSFIKGDDFNACAQLVVLSYPDLKLLYEDSQMVTLTAPYVAGFLAFRETPFLLEALQRLRMKQPNLLPQVVFVDGNGLFHYREFGLACHLGVLSGLPCVGVAKNLLQVQGVHKSEEHQAQIAALQKGGDSFPLTAASGKVLGKALRSSDSSSKPVYVSVGHRISLDTAVRLTHSCCRYRVPEPIRQADCRSREYLRKHFPAADACTKE"	"unreviewed"	"{'taxId': '210632', 'scientificName': 'Parambassis ranga', 'fullName': 'Parambassis ranga (Indian glassy fish)'}"