GET /api/protein/UniProt/A0A673FMA5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A673FMA5",
        "id": "A0A673FMA5_9TELE",
        "source_organism": {
            "taxId": "307959",
            "scientificName": "Sinocyclocheilus rhinocerous",
            "fullName": "Sinocyclocheilus rhinocerous"
        },
        "name": "Core-binding factor subunit beta",
        "description": [
            "Forms the heterodimeric complex core-binding factor (CBF) with RUNX family proteins (RUNX1, RUNX2, and RUNX3). RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation"
        ],
        "length": 201,
        "sequence": "MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPANLHGDQRQAPSREYVDFERETGKVYLKAPMILNGVCVIWRGSIDLQRLDGMGCLEYDDERAQHEDALAQAAFEETRRRTRDFEDRDRSHREDMEQMPMAQLSHLITQEPRRQQDPSPGSNMGNTDDHKMR",
        "proteome": "UP000472270",
        "gene": "LOC107715210",
        "go_terms": [
            {
                "identifier": "GO:0003713",
                "name": "transcription coactivator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4f81a3cba7f5268c02d3532614e1c5139b41efa7",
        "counters": {
            "domain_architectures": 2162,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2162
        }
    }
}