HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A673FMA5",
"id": "A0A673FMA5_9TELE",
"source_organism": {
"taxId": "307959",
"scientificName": "Sinocyclocheilus rhinocerous",
"fullName": "Sinocyclocheilus rhinocerous"
},
"name": "Core-binding factor subunit beta",
"description": [
"Forms the heterodimeric complex core-binding factor (CBF) with RUNX family proteins (RUNX1, RUNX2, and RUNX3). RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation"
],
"length": 201,
"sequence": "MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPANLHGDQRQAPSREYVDFERETGKVYLKAPMILNGVCVIWRGSIDLQRLDGMGCLEYDDERAQHEDALAQAAFEETRRRTRDFEDRDRSHREDMEQMPMAQLSHLITQEPRRQQDPSPGSNMGNTDDHKMR",
"proteome": "UP000472270",
"gene": "LOC107715210",
"go_terms": [
{
"identifier": "GO:0003713",
"name": "transcription coactivator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4f81a3cba7f5268c02d3532614e1c5139b41efa7",
"counters": {
"domain_architectures": 2162,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2162
}
}
}