"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A673FMA5"	"{'domain_architectures': 2000, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2000}"	"[""Forms the heterodimeric complex core-binding factor (CBF) with RUNX family proteins (RUNX1, RUNX2, and RUNX3). RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation""]"	"LOC107715210"	"[{'identifier': 'GO:0003713', 'name': 'transcription coactivator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005634', 'name': 'nucleus', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A673FMA5_9TELE"	"4f81a3cba7f5268c02d3532614e1c5139b41efa7"	True	False	201	"Core-binding factor subunit beta"	3	"UP000472270"	"MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPANLHGDQRQAPSREYVDFERETGKVYLKAPMILNGVCVIWRGSIDLQRLDGMGCLEYDDERAQHEDALAQAAFEETRRRTRDFEDRDRSHREDMEQMPMAQLSHLITQEPRRQQDPSPGSNMGNTDDHKMR"	"unreviewed"	"{'taxId': '307959', 'scientificName': 'Sinocyclocheilus rhinocerous', 'fullName': 'Sinocyclocheilus rhinocerous'}"