HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3P9C0N6",
"id": "A0A3P9C0N6_9CICH",
"source_organism": {
"taxId": "106582",
"scientificName": "Maylandia zebra",
"fullName": "Maylandia zebra (zebra mbuna)"
},
"name": "Anaphase-promoting complex subunit 11",
"description": [
"Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The APC/C complex catalyzes assembly of branched 'Lys-11'-/'Lys-48'-linked branched ubiquitin chains on target proteins. May recruit the E2 ubiquitin-conjugating enzymes to the complex"
],
"length": 94,
"sequence": "MRLCSCQIRRMKVKIKQWNGVASWLWVANDDNCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNSQQVQQQCPMCRQEWKFKE",
"proteome": "UP000265160",
"gene": null,
"go_terms": [
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0061630",
"name": "ubiquitin protein ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0097602",
"name": "cullin family protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0031145",
"name": "anaphase-promoting complex-dependent catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005680",
"name": "anaphase-promoting complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4413c68b229aca9bf8d0fab9eb370c1f77d8b15c",
"counters": {
"domain_architectures": 3293,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3293
}
}
}