GET /api/protein/UniProt/A0A3P9C0N6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3P9C0N6",
        "id": "A0A3P9C0N6_9CICH",
        "source_organism": {
            "taxId": "106582",
            "scientificName": "Maylandia zebra",
            "fullName": "Maylandia zebra (zebra mbuna)"
        },
        "name": "Anaphase-promoting complex subunit 11",
        "description": [
            "Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The APC/C complex catalyzes assembly of branched 'Lys-11'-/'Lys-48'-linked branched ubiquitin chains on target proteins. May recruit the E2 ubiquitin-conjugating enzymes to the complex"
        ],
        "length": 94,
        "sequence": "MRLCSCQIRRMKVKIKQWNGVASWLWVANDDNCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNSQQVQQQCPMCRQEWKFKE",
        "proteome": "UP000265160",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0061630",
                "name": "ubiquitin protein ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0097602",
                "name": "cullin family protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0031145",
                "name": "anaphase-promoting complex-dependent catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005680",
                "name": "anaphase-promoting complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4413c68b229aca9bf8d0fab9eb370c1f77d8b15c",
        "counters": {
            "domain_architectures": 3293,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3293
        }
    }
}