"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3P9C0N6"	"{'domain_architectures': 3293, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3293}"	"[""Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The APC/C complex catalyzes assembly of branched 'Lys-11'-/'Lys-48'-linked branched ubiquitin chains on target proteins. May recruit the E2 ubiquitin-conjugating enzymes to the complex""]"	""	"[{'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0061630', 'name': 'ubiquitin protein ligase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0097602', 'name': 'cullin family protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0031145', 'name': 'anaphase-promoting complex-dependent catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005680', 'name': 'anaphase-promoting complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A3P9C0N6_9CICH"	"4413c68b229aca9bf8d0fab9eb370c1f77d8b15c"	True	False	False	94	"Anaphase-promoting complex subunit 11"	3	"UP000265160"	"MRLCSCQIRRMKVKIKQWNGVASWLWVANDDNCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNSQQVQQQCPMCRQEWKFKE"	"unreviewed"	"{'taxId': '106582', 'scientificName': 'Maylandia zebra', 'fullName': 'Maylandia zebra (zebra mbuna)'}"