General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3B3TM62",
        "id": "A0A3B3TM62_9TELE",
        "source_organism": {
            "taxId": "48699",
            "scientificName": "Poecilia latipinna",
            "fullName": "Poecilia latipinna (sailfin molly)"
        },
        "name": "Abasic site processing protein HMCES",
        "description": [
            "Sensor of abasic sites in single-stranded DNA (ssDNA) required to preserve genome integrity by promoting error-free repair of abasic sites. Acts as an enzyme that recognizes and binds abasic sites in ssDNA at replication forks and chemically modifies the lesion by forming a covalent cross-link with DNA: forms a stable thiazolidine linkage between a ring-opened abasic site and the alpha-amino and sulfhydryl substituents of its N-terminal catalytic cysteine residue. The HMCES DNA-protein cross-link is then either reversed or degraded. HMCES is able to catalyze the reversal of its thiazolidine cross-link and cycle between a cross-link and a non-cross-linked state depending on DNA context: mediates self-reversal of the thiazolidine cross-link in double stranded DNA, allowing APEX1 to initiate downstream repair of abasic sites. The HMCES DNA-protein cross-link can also be degraded by the SPRTN metalloprotease following unfolding by the BRIP1/FANCJ helicase. Acts as a protease: mediates autocatalytic processing of its N-terminal methionine in order to expose the catalytic cysteine"
        ],
        "length": 362,
        "sequence": "MCGRTACTLAPDEVSRACSYRNRGGQRRQPRWRDGDADKYRPSYNKSLQSMSPVLVSQRHFDKTAPVDECVLASMRWGLIPAWFKESDPSKMQYSTSNCRSENILEKKSYKDPLLKGQRCVIMADGFYEWQRVEKEKQPFFIYFPQKNGPSQERKEDQQQDVTSSTCNTVVSEKGEISHDLAEESEAPAEWTGWRLLTMAGVFDCWTPPGGGEALYTYSVITVNASPNLQSIHDRMPAILDGEDEVRRWLDFGEVKSLDAIKLLQSKDVLTFHPVSSFVNNSRNNSPECLQPVDLSRKKEIKATASSKMMMSWLSSGSPAKRKEPDTNETKGEQDSKAKSRCKPAGGLQLWLQGANKKPRTK",
        "proteome": "UP000261500",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003697",
                "name": "single-stranded DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006974",
                "name": "DNA damage response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0106300",
                "name": "protein-DNA covalent cross-linking repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "547c439dfd7afa9f6ed8bb0f63dd9ad6a6f27c6d",
        "counters": {
            "domain_architectures": 26373,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 26373
        }
    }
}