"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3B3TM62"	"{'domain_architectures': 26373, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 26373}"	"['Sensor of abasic sites in single-stranded DNA (ssDNA) required to preserve genome integrity by promoting error-free repair of abasic sites. Acts as an enzyme that recognizes and binds abasic sites in ssDNA at replication forks and chemically modifies the lesion by forming a covalent cross-link with DNA: forms a stable thiazolidine linkage between a ring-opened abasic site and the alpha-amino and sulfhydryl substituents of its N-terminal catalytic cysteine residue. The HMCES DNA-protein cross-link is then either reversed or degraded. HMCES is able to catalyze the reversal of its thiazolidine cross-link and cycle between a cross-link and a non-cross-linked state depending on DNA context: mediates self-reversal of the thiazolidine cross-link in double stranded DNA, allowing APEX1 to initiate downstream repair of abasic sites. The HMCES DNA-protein cross-link can also be degraded by the SPRTN metalloprotease following unfolding by the BRIP1/FANCJ helicase. Acts as a protease: mediates autocatalytic processing of its N-terminal methionine in order to expose the catalytic cysteine']"	""	"[{'identifier': 'GO:0003697', 'name': 'single-stranded DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006974', 'name': 'DNA damage response', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0106300', 'name': 'protein-DNA covalent cross-linking repair', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A3B3TM62_9TELE"	"547c439dfd7afa9f6ed8bb0f63dd9ad6a6f27c6d"	True	False	False	362	"Abasic site processing protein HMCES"	3	"UP000261500"	"MCGRTACTLAPDEVSRACSYRNRGGQRRQPRWRDGDADKYRPSYNKSLQSMSPVLVSQRHFDKTAPVDECVLASMRWGLIPAWFKESDPSKMQYSTSNCRSENILEKKSYKDPLLKGQRCVIMADGFYEWQRVEKEKQPFFIYFPQKNGPSQERKEDQQQDVTSSTCNTVVSEKGEISHDLAEESEAPAEWTGWRLLTMAGVFDCWTPPGGGEALYTYSVITVNASPNLQSIHDRMPAILDGEDEVRRWLDFGEVKSLDAIKLLQSKDVLTFHPVSSFVNNSRNNSPECLQPVDLSRKKEIKATASSKMMMSWLSSGSPAKRKEPDTNETKGEQDSKAKSRCKPAGGLQLWLQGANKKPRTK"	"unreviewed"	"{'taxId': '48699', 'scientificName': 'Poecilia latipinna', 'fullName': 'Poecilia latipinna (sailfin molly)'}"