GET /api/protein/UniProt/A0A287B2D7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A287B2D7",
        "id": "A0A287B2D7_PIG",
        "source_organism": {
            "taxId": "9823",
            "scientificName": "Sus scrofa",
            "fullName": "Sus scrofa (Pig)"
        },
        "name": "Dolichol phosphate-mannose biosynthesis regulatory protein",
        "description": [
            "Regulates the biosynthesis of dolichol phosphate-mannose. Regulatory subunit of the dolichol-phosphate mannose (DPM) synthase complex; essential for the ER localization and stable expression of DPM1. Part of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex that catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol and participates in the first step of GPI biosynthesis. May act by regulating the GPI-GNT complex",
            "Regulatory subunit of the dolichol-phosphate mannose (DPM) synthase complex; essential for the ER localization"
        ],
        "length": 84,
        "sequence": "MATGTDQVVGLGLVAVSLIIFTYYTTWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGVFITSVMLKSQKVTKKAQ",
        "proteome": "UP000008227",
        "gene": "DPM2",
        "go_terms": [
            {
                "identifier": "GO:0030234",
                "name": "enzyme regulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0180047",
                "name": "dolichol phosphate mannose biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005789",
                "name": "endoplasmic reticulum membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7878cb2ac137a5cc1fbe88804d5d3b7ed8b7c749",
        "counters": {
            "domain_architectures": 2983,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2983
        }
    }
}