"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A287B2D7"	"{'domain_architectures': 2734, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2734}"	"['Regulates the biosynthesis of dolichol phosphate-mannose. Regulatory subunit of the dolichol-phosphate mannose (DPM) synthase complex; essential for the ER localization and stable expression of DPM1. Part of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex that catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol and participates in the first step of GPI biosynthesis. May act by regulating the GPI-GNT complex', 'Regulatory subunit of the dolichol-phosphate mannose (DPM) synthase complex; essential for the ER localization']"	"DPM2"	"[{'identifier': 'GO:0030234', 'name': 'enzyme regulator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0180047', 'name': 'dolichol phosphate mannose biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005789', 'name': 'endoplasmic reticulum membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A287B2D7_PIG"	"7878cb2ac137a5cc1fbe88804d5d3b7ed8b7c749"	True	False	84	"Dolichol phosphate-mannose biosynthesis regulatory protein"	3	"UP000008227"	"MATGTDQVVGLGLVAVSLIIFTYYTTWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGVFITSVMLKSQKVTKKAQ"	"unreviewed"	"{'taxId': '9823', 'scientificName': 'Sus scrofa', 'fullName': 'Sus scrofa (Pig)'}"