General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0N8EUF1",
        "id": "A0A0N8EUF1_HETGA",
        "source_organism": {
            "taxId": "10181",
            "scientificName": "Heterocephalus glaber",
            "fullName": "Heterocephalus glaber (Naked mole rat)"
        },
        "name": "rRNA methyltransferase 2, mitochondrial",
        "description": [
            "S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methyluridine at position 1369 (Um1369) in the 16S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA. This activity may require prior 2'-O-methylguanosine modification at position 1370 (Gm1370) by MRM3. Essential for late-stage assembly of mtLSU required for efficient translation of mitochondrial DNA encoded proteins; methyltransferase activity is not required for this function. Essential for mitochondrial respiratory function"
        ],
        "length": 246,
        "sequence": "MAGYWKLVCASLFCERFHTAAQHYKGRTGAEHLWLMRHLKDPYVKAAKVECYRCRSAFKLLEMNEKHGILRPGLRVLDCGAAPGAWSQVAVQRVNATGADPSFPVGFVLGVDLLHIHPLEGATFLSPADVTDPRTFQRIMELLPCGKADVILSDMAPNATGIRDLDHDRLISMCLSLLDMAPDILHPGGTVLCKTWAGSQSRRLQKRLTEEFQNTRTIKPEASRKESSEVYFLATQYRRRKGSVKQ",
        "proteome": null,
        "gene": "FTSJ2",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0001510",
                "name": "RNA methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0032259",
                "name": "methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "71a5d42e748b06cd2d42035318a449fe592a7c1a",
        "counters": {
            "domain_architectures": 26600,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26600
        }
    }
}