"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A0N8EUF1"	"{'domain_architectures': 26600, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pirsf': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 26600}"	"[""S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methyluridine at position 1369 (Um1369) in the 16S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA. This activity may require prior 2'-O-methylguanosine modification at position 1370 (Gm1370) by MRM3. Essential for late-stage assembly of mtLSU required for efficient translation of mitochondrial DNA encoded proteins; methyltransferase activity is not required for this function. Essential for mitochondrial respiratory function""]"	"FTSJ2"	"[{'identifier': 'GO:0008168', 'name': 'methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0001510', 'name': 'RNA methylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0032259', 'name': 'methylation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A0N8EUF1_HETGA"	"71a5d42e748b06cd2d42035318a449fe592a7c1a"	True	False	False	246	"rRNA methyltransferase 2, mitochondrial"	3	""	"MAGYWKLVCASLFCERFHTAAQHYKGRTGAEHLWLMRHLKDPYVKAAKVECYRCRSAFKLLEMNEKHGILRPGLRVLDCGAAPGAWSQVAVQRVNATGADPSFPVGFVLGVDLLHIHPLEGATFLSPADVTDPRTFQRIMELLPCGKADVILSDMAPNATGIRDLDHDRLISMCLSLLDMAPDILHPGGTVLCKTWAGSQSRRLQKRLTEEFQNTRTIKPEASRKESSEVYFLATQYRRRKGSVKQ"	"unreviewed"	"{'taxId': '10181', 'scientificName': 'Heterocephalus glaber', 'fullName': 'Heterocephalus glaber (Naked mole rat)'}"
