General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A091RY44",
        "id": "A0A091RY44_NESNO",
        "source_organism": {
            "taxId": "176057",
            "scientificName": "Nestor notabilis",
            "fullName": "Nestor notabilis (Kea)"
        },
        "name": "Presenilin",
        "description": [
            "Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. May function in the cytoplasmic partitioning of proteins. The holoprotein functions as a calcium-leak channel that allows the passive movement of calcium from endoplasmic reticulum to cytosol and is involved in calcium homeostasis. Is a regulator of mitochondrion-endoplasmic reticulum membrane tethering and modulates calcium ions shuttling between ER and mitochondria",
            "Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors"
        ],
        "length": 458,
        "sequence": "MITFMNNSDSEEEPCNERTSLMSAESPPVPSYQDGLQASGAGEAQAHRKRRTGSSRSPNNIAEGEMSDSGVPVRGSALENEEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFSEDTPSVGQRLLNSVLNTIIMISVIVVMTVFLVLLYKYRCYKFIHGWLILSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLFLVIWNFGAVGMICIHWKGPLQLQQAYLIMISALMALVFIKYLPEWSAWVILGAISIYDLMAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMMWTVGMAKPDTAARGPSQQMWDAAEDGRDNHGSSSHTDSQMSETRSPVPTRPITSLEELEEEERGVKLGLGDFIFYSVLVGKAAATASGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISITFGLVFYFSTDNLVRPFMDTLASHQLYI",
        "proteome": "UP000053840",
        "gene": "N333_10345",
        "go_terms": [
            {
                "identifier": "GO:0042500",
                "name": "aspartic endopeptidase activity, intramembrane cleaving",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016485",
                "name": "protein processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0035556",
                "name": "intracellular signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042987",
                "name": "amyloid precursor protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c661181a01b211ed2d1c8b8b5e8a3bdf1b271f93",
        "counters": {
            "domain_architectures": 4227,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "prints": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4227
        }
    }
}