"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A091RY44"	"{'domain_architectures': 4227, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'prints': 2, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4227}"	"['Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. May function in the cytoplasmic partitioning of proteins. The holoprotein functions as a calcium-leak channel that allows the passive movement of calcium from endoplasmic reticulum to cytosol and is involved in calcium homeostasis. Is a regulator of mitochondrion-endoplasmic reticulum membrane tethering and modulates calcium ions shuttling between ER and mitochondria', 'Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors']"	"N333_10345"	"[{'identifier': 'GO:0042500', 'name': 'aspartic endopeptidase activity, intramembrane cleaving', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016485', 'name': 'protein processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0035556', 'name': 'intracellular signal transduction', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0042987', 'name': 'amyloid precursor protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A091RY44_NESNO"	"c661181a01b211ed2d1c8b8b5e8a3bdf1b271f93"	True	False	False	458	"Presenilin"	3	"UP000053840"	"MITFMNNSDSEEEPCNERTSLMSAESPPVPSYQDGLQASGAGEAQAHRKRRTGSSRSPNNIAEGEMSDSGVPVRGSALENEEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFSEDTPSVGQRLLNSVLNTIIMISVIVVMTVFLVLLYKYRCYKFIHGWLILSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLFLVIWNFGAVGMICIHWKGPLQLQQAYLIMISALMALVFIKYLPEWSAWVILGAISIYDLMAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMMWTVGMAKPDTAARGPSQQMWDAAEDGRDNHGSSSHTDSQMSETRSPVPTRPITSLEELEEEERGVKLGLGDFIFYSVLVGKAAATASGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISITFGLVFYFSTDNLVRPFMDTLASHQLYI"	"unreviewed"	"{'taxId': '176057', 'scientificName': 'Nestor notabilis', 'fullName': 'Nestor notabilis (Kea)'}"