› › Leading Chain of the AAB Collagen Heterotrimer

Leading Chain of the AAB Collagen Heterotrimer in PDB entry 6q3p, assembly 1, front view.
Leading Chain of the AAB Collagen Heterotrimer in PDB entry 6q3p, assembly 1, side view.
Leading Chain of the AAB Collagen Heterotrimer in PDB entry 6q3p, assembly 1, top view.
Chain: A
Length: 49 amino acids
Theoretical weight: 4.39 KDa
Source organism: Homo sapiens
Expression system: Not provided
FASTA Sequence
>pdb|6q3p|A
GPPGPKGDPGPKGDPGPPGARGQAGVLGFPGPPGPPGPKGDKGDPGGYX

Quick links

Search similar proteins