› › Golgi to ER traffic protein 1

Golgi to ER traffic protein 1 in PDB entry 3b2e, assembly 1, front view.
Golgi to ER traffic protein 1 in PDB entry 3b2e, assembly 1, side view.
Golgi to ER traffic protein 1 in PDB entry 3b2e, assembly 1, top view.
Chains: E, F, G, H
Length: 84 amino acids
Theoretical weight: 10.06 KDa
Source organism: Saccharomyces cerevisiae S288C
Expression system: Escherichia coli
UniProt:
  • Canonical: P53192 (Residues: 21-104; Coverage: 36%)
Gene names: GET1, MDM39, YGL020C
FASTA Sequence
>pdb|3b2e|E F G H
TNKYHEKWISKFAPGNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHKLR
PDBe-KB: UniProt Coverage View: P53192  

Quick links

Search similar proteins