PDB 6d6n biological assemblies and structure analysis ‹ Protein Data Bank in Europe (PDBe)

Assemblies

Assembly 1 (preferred)

Download 3D Visualisation

Assembly Name: Transcriptional activator protein LasR
hide full assembly name

Multimeric state: homo dimer

Accessible surface area: 15850.71 Å²

Buried surface area: 1823.56 Å²

Dissociation area: 911.78 Å²

Dissociation energy (ΔG^diss): 2.21 kcal/mol

Dissociation entropy (TΔS^diss): 12.15 kcal/mol

Symmetry number: 2

PDBe Complex ID: PDB-CPX-150367

$Homo dimeric assembly 1 of PDB entry 6d6n coloured by chemically distinct molecules, front view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>2 copies of Transcriptional activator protein LasR;</li> <li class='image_legend_li'>2 copies of 2,4-dibromo-6-{[(2-nitrobenzene-1-carbonyl)amino]methyl}phenyl 4-methoxybenzoate;</li> <li class='image_legend_li'>1 copy of PHENYLALANINE;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

$Homo dimeric assembly 1 of PDB entry 6d6n coloured by chemically distinct molecules, side view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>2 copies of Transcriptional activator protein LasR;</li> <li class='image_legend_li'>2 copies of 2,4-dibromo-6-{[(2-nitrobenzene-1-carbonyl)amino]methyl}phenyl 4-methoxybenzoate;</li> <li class='image_legend_li'>1 copy of PHENYLALANINE;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

$Homo dimeric assembly 1 of PDB entry 6d6n coloured by chemically distinct molecules, top view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>2 copies of Transcriptional activator protein LasR;</li> <li class='image_legend_li'>2 copies of 2,4-dibromo-6-{[(2-nitrobenzene-1-carbonyl)amino]methyl}phenyl 4-methoxybenzoate;</li> <li class='image_legend_li'>1 copy of PHENYLALANINE;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

Assembly 2

Download 3D Visualisation

Assembly Name: Transcriptional activator protein LasR
hide full assembly name

Multimeric state: homo dimer

Accessible surface area: 14766.54 Å²

Buried surface area: 1794.25 Å²

Dissociation area: 897.13 Å²

Dissociation energy (ΔG^diss): 2.9 kcal/mol

Dissociation entropy (TΔS^diss): 11.98 kcal/mol

Symmetry number: 2

PDBe Complex ID: PDB-CPX-150367

$Homo dimeric assembly 2 of PDB entry 6d6n coloured by chemically distinct molecules, front view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>2 copies of Transcriptional activator protein LasR;</li> <li class='image_legend_li'>2 copies of 2,4-dibromo-6-{[(2-nitrobenzene-1-carbonyl)amino]methyl}phenyl 4-methoxybenzoate;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

$Homo dimeric assembly 2 of PDB entry 6d6n coloured by chemically distinct molecules, side view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>2 copies of Transcriptional activator protein LasR;</li> <li class='image_legend_li'>2 copies of 2,4-dibromo-6-{[(2-nitrobenzene-1-carbonyl)amino]methyl}phenyl 4-methoxybenzoate;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

$Homo dimeric assembly 2 of PDB entry 6d6n coloured by chemically distinct molecules, top view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>2 copies of Transcriptional activator protein LasR;</li> <li class='image_legend_li'>2 copies of 2,4-dibromo-6-{[(2-nitrobenzene-1-carbonyl)amino]methyl}phenyl 4-methoxybenzoate;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

Macromolecules

Transcriptional activator protein LasR

Chains: A, B, C, D
Length: 170 amino acids
Theoretical weight: 19.01 KDa
Source organism: Pseudomonas aeruginosa PAO1
Expression system: Escherichia coli
UniProt:

Canonical: P25084 (Residues: 1-170; Coverage: 71%)

Gene names: PA1430, lasR
Pfam: Autoinducer binding domain
InterPro:

Transcription factor LuxR-like, autoinducer-binding domain superfamily
Transcription factor LuxR-like, autoinducer-binding domain

CATH: Transcription factor LuxR-like, autoinducer-binding domain

Transcriptional activator protein LasR in PDB entry 6d6n, assembly 1, front view.

Transcriptional activator protein LasR in PDB entry 6d6n, assembly 1, side view.

Transcriptional activator protein LasR in PDB entry 6d6n, assembly 1, top view.

FASTA Sequence


    >pdb|6d6n|A B C D

MALVDGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHP

PDBe-KB: UniProt Coverage View: P25084

Molecule details ›

Download

FASTA (Protein chains A, B, C, D)
Archive mmCIF file
Updated mmCIF file
PDB file
PDB header
PDB file (gz)
PDBML
PDBML (ATOM lines)
PDBML (no atoms)
Structure Factors
SIFTS XML file with residue-level mappings

Search similar proteins

Similar 3D structures (PDBeFold)
Similar sequences

BLAST P25084 (UniProt)

Protein Data Bank in Europe

The structure of ligand binding domain of LasR in complex with TP-1 homolog, compound 16

Quick links

Assemblies

Assembly 1 (preferred)

Assembly 2

Macromolecules

Search similar proteins

Quick links

PDBe › 6d6n › Structure analysis

The structure of ligand binding domain of LasR in complex with TP-1 homolog, compound 16

Quick links

Assemblies

Assembly 1 (preferred)

Assembly 2

Macromolecules

Search similar proteins

Quick links

6d6n › Structure analysis