HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "M6UP48",
"id": "M6UP48_9LEPT",
"source_organism": {
"taxId": "1049985",
"scientificName": "Leptospira santarosai str. ZUN179",
"fullName": "Leptospira santarosai str. ZUN179"
},
"name": "Oxygen sensor histidine kinase NreB",
"description": [
"Member of the two-component regulatory system NreB/NreC involved in the control of dissimilatory nitrate/nitrite reduction in response to oxygen. NreB functions as a direct oxygen sensor histidine kinase which is autophosphorylated, in the absence of oxygen, probably at the conserved histidine residue, and transfers its phosphate group probably to a conserved aspartate residue of NreC. NreB/NreC activates the expression of the nitrate (narGHJI) and nitrite (nir) reductase operons, as well as the putative nitrate transporter gene narT"
],
"length": 356,
"sequence": "MRDPKRKTGKSLSPPIILKSGLSPKFFLNLLKEISPIVAIDDKRAILFANESFRKEFAGNSRNLMGKNLFRIFGLNPVDQEEMESNIKLSKKGMVQNQEFKKQKIYYGYSVFRFGESIGIILKNITENKRLEKKIANLHTKLLQSQEEERIRLSRELHDGVGQTILAAKLNFQAYNRNPKVYGAQFDTGLLLIDKASQELRDIYTNLHPSTLREIGLEAAIRALSSDLFPPMDVEADLDLNLKRDLEPAIANQIFRIVQEIFQNVIKHSQARKIYLKVHVKGRQLFLDAKDNGIGFQEKKARVKSSGFGLENIRRRVEDLNGKFKIDSSSGEGTKFIVRIPLEKTKTHSPKKYENY",
"proteome": null,
"gene": "LEP1GSC187_0937",
"go_terms": [
{
"identifier": "GO:0000155",
"name": "phosphorelay sensor kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000160",
"name": "phosphorelay signal transduction system",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016772",
"name": "transferase activity, transferring phosphorus-containing groups",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016310",
"name": "phosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2cbb28090dd09ba9eade30e5c42440c887294ac5",
"counters": {
"domain_architectures": 55892,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"pfam": 2,
"profile": 1,
"ssf": 1,
"smart": 1,
"cdd": 1,
"panther": 1,
"prints": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 55892
}
}
}