GET /api/protein/unreviewed/M6UP48/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "M6UP48",
        "id": "M6UP48_9LEPT",
        "source_organism": {
            "taxId": "1049985",
            "scientificName": "Leptospira santarosai str. ZUN179",
            "fullName": "Leptospira santarosai str. ZUN179"
        },
        "name": "Oxygen sensor histidine kinase NreB",
        "description": [
            "Member of the two-component regulatory system NreB/NreC involved in the control of dissimilatory nitrate/nitrite reduction in response to oxygen. NreB functions as a direct oxygen sensor histidine kinase which is autophosphorylated, in the absence of oxygen, probably at the conserved histidine residue, and transfers its phosphate group probably to a conserved aspartate residue of NreC. NreB/NreC activates the expression of the nitrate (narGHJI) and nitrite (nir) reductase operons, as well as the putative nitrate transporter gene narT"
        ],
        "length": 356,
        "sequence": "MRDPKRKTGKSLSPPIILKSGLSPKFFLNLLKEISPIVAIDDKRAILFANESFRKEFAGNSRNLMGKNLFRIFGLNPVDQEEMESNIKLSKKGMVQNQEFKKQKIYYGYSVFRFGESIGIILKNITENKRLEKKIANLHTKLLQSQEEERIRLSRELHDGVGQTILAAKLNFQAYNRNPKVYGAQFDTGLLLIDKASQELRDIYTNLHPSTLREIGLEAAIRALSSDLFPPMDVEADLDLNLKRDLEPAIANQIFRIVQEIFQNVIKHSQARKIYLKVHVKGRQLFLDAKDNGIGFQEKKARVKSSGFGLENIRRRVEDLNGKFKIDSSSGEGTKFIVRIPLEKTKTHSPKKYENY",
        "proteome": null,
        "gene": "LEP1GSC187_0937",
        "go_terms": [
            {
                "identifier": "GO:0000155",
                "name": "phosphorelay sensor kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000160",
                "name": "phosphorelay signal transduction system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016772",
                "name": "transferase activity, transferring phosphorus-containing groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016310",
                "name": "phosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2cbb28090dd09ba9eade30e5c42440c887294ac5",
        "counters": {
            "domain_architectures": 55892,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "pfam": 2,
                "profile": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 55892
        }
    }
}