General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3SNH9",
        "id": "G3SNH9_LOXAF",
        "source_organism": {
            "taxId": "9785",
            "scientificName": "Loxodonta africana",
            "fullName": "Loxodonta africana (African elephant)"
        },
        "name": "Pterin-4-alpha-carbinolamine dehydratase",
        "description": [
            "Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. Also acts as a coactivator for HNF1B-dependent transcription"
        ],
        "length": 104,
        "sequence": "QAGKAHRLSAEERDQLLPNLRAVGWNEVEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT",
        "proteome": "UP000007646",
        "gene": "PCBD1",
        "go_terms": [
            {
                "identifier": "GO:0008124",
                "name": "4-alpha-hydroxytetrahydrobiopterin dehydratase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006729",
                "name": "tetrahydrobiopterin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e369d4a6ba0e4ec491088fa090c6667d92b80728",
        "counters": {
            "domain_architectures": 21046,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 2,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21046
        }
    }
}