General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G1SLB5",
        "id": "G1SLB5_RABIT",
        "source_organism": {
            "taxId": "9986",
            "scientificName": "Oryctolagus cuniculus",
            "fullName": "Oryctolagus cuniculus (Rabbit)"
        },
        "name": "Monocyte differentiation antigen CD14",
        "description": [
            "Coreceptor for bacterial lipopolysaccharide. In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-)"
        ],
        "length": 372,
        "sequence": "MEPVPCLLLLLLPLLRASTDTPEPCELDDDDIRCVCNFSDPQPDWSSALQCMPAVQVEMWGGGHSLEQFLRQADLYTDQRRYADVVKALRVRRLTVGAVQVPAPLLLGVLRVLGYSRLKELALEDIEVTGTAPPPPPLEATGPALSTLSLRNVSWPKGGAWLSELQQWLKPGLQVLNIAQAHTLAFSCEQVRTFSALTTLDLSENPGLGERGLVAALCPHKFPALQDLALRNAGMKTLQGVCAALAEAGVQPHHLDLSHNSLRADTQGCIWPSALNSLNLSFTGLQQVPKGLPAKLNVLDLSCNKLNRAPQPGELPKVVNLSLDGNPFLVPGASKLQEDLTNSGVFPACPPSPLAMGMSGTLALLQGARGFI",
        "proteome": "UP000001811",
        "gene": "CD14",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}