General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D4INT3",
        "id": "D4INT3_9BACT",
        "source_organism": {
            "taxId": "717959",
            "scientificName": "Alistipes shahii WAL 8301",
            "fullName": "Alistipes shahii WAL 8301"
        },
        "name": "NADH-quinone oxidoreductase subunit J",
        "description": [
            "NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient"
        ],
        "length": 169,
        "sequence": "MEITLELIVFTVLALFIGVSAILAVTTRRILRAATYLLFVLFGTAGIYFQLNYSFLGAVQLLIYAGGITVLYVFSILLTSSQGDKAEDLKGYKLFVGLGAALASLGICLWITLRHDFLPSHFEHGELHVRTIGHALMSSGKYGYILPFEVISLLLLACIVGGILIARKR",
        "proteome": "UP000008794",
        "gene": "AL1_23440",
        "go_terms": [
            {
                "identifier": "GO:0008137",
                "name": "NADH dehydrogenase (ubiquinone) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "96cfd4c69773af29d548fde0c6c747d9cca5615a",
        "counters": {
            "domain_architectures": 51372,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 51372
        }
    }
}