"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D4INT3"	"{'domain_architectures': 51372, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 51372}"	"['NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient']"	"AL1_23440"	"[{'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"D4INT3_9BACT"	"96cfd4c69773af29d548fde0c6c747d9cca5615a"	True	False	False	169	"NADH-quinone oxidoreductase subunit J"	3	"UP000008794"	"MEITLELIVFTVLALFIGVSAILAVTTRRILRAATYLLFVLFGTAGIYFQLNYSFLGAVQLLIYAGGITVLYVFSILLTSSQGDKAEDLKGYKLFVGLGAALASLGICLWITLRHDFLPSHFEHGELHVRTIGHALMSSGKYGYILPFEVISLLLLACIVGGILIARKR"	"unreviewed"	"{'taxId': '717959', 'scientificName': 'Alistipes shahii WAL 8301', 'fullName': 'Alistipes shahii WAL 8301'}"
