General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D3GWN7",
        "id": "D3GWN7_ECO44",
        "source_organism": {
            "taxId": "216592",
            "scientificName": "Escherichia coli O44:H18 (strain 042 / EAEC)",
            "fullName": "Escherichia coli O44:H18 (strain 042 / EAEC)"
        },
        "name": "G/U mismatch-specific DNA glycosylase",
        "description": [
            "Excises ethenocytosine and uracil, which can arise by alkylation or deamination of cytosine, respectively, from the corresponding mispairs with guanine in ds-DNA. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and the mispaired base. The complementary strand guanine functions in substrate recognition. Required for DNA damage lesion repair in stationary-phase cells"
        ],
        "length": 168,
        "sequence": "MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPNPSGLSRVSLEKLVEAYRELDQALVVRGR",
        "proteome": null,
        "gene": "mug",
        "go_terms": [
            {
                "identifier": "GO:0000700",
                "name": "mismatch base pair DNA N-glycosylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006285",
                "name": "base-excision repair, AP site formation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6d3eb109c1e174cd82c598bd72ab8f3ce4283767",
        "counters": {
            "domain_architectures": 69726,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 69726
        }
    }
}