General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B6HTN3",
        "id": "B6HTN3_PENRW",
        "source_organism": {
            "taxId": "500485",
            "scientificName": "Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)",
            "fullName": "Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)"
        },
        "name": "Iron-sulfur cluster assembly protein",
        "description": [
            "Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins"
        ],
        "length": 199,
        "sequence": "MFKRLVTVAPRVGSIATRSTLSPLAGLQSAQPAIRRAAPAPAQQRRGYHEKVLDHYNNPRNVGSMKKGDQDVGTGLVGAPACGDVMKLQIRVNKDSGRIDDVVFKTFGCGSAIASSSYLTELVRGMTLDEAGKIKNTDVAKELCLPPVKLHCSMLAEDAIKSAIANYYTKNPNTRATDLSGTGGVIPDVTVETTTSPAA",
        "proteome": "UP000000724",
        "gene": "PCH_Pc22g17800",
        "go_terms": [
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016226",
                "name": "iron-sulfur cluster assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1a14465eba7d2532ef70113b6acb6327d7aa9427",
        "counters": {
            "domain_architectures": 26938,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 26938
        }
    }
}