"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B6HTN3"	"{'domain_architectures': 26938, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 26938}"	"['Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins']"	"PCH_Pc22g17800"	"[{'identifier': 'GO:0005506', 'name': 'iron ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016226', 'name': 'iron-sulfur cluster assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B6HTN3_PENRW"	"1a14465eba7d2532ef70113b6acb6327d7aa9427"	True	False	False	199	"Iron-sulfur cluster assembly protein"	3	"UP000000724"	"MFKRLVTVAPRVGSIATRSTLSPLAGLQSAQPAIRRAAPAPAQQRRGYHEKVLDHYNNPRNVGSMKKGDQDVGTGLVGAPACGDVMKLQIRVNKDSGRIDDVVFKTFGCGSAIASSSYLTELVRGMTLDEAGKIKNTDVAKELCLPPVKLHCSMLAEDAIKSAIANYYTKNPNTRATDLSGTGGVIPDVTVETTTSPAA"	"unreviewed"	"{'taxId': '500485', 'scientificName': 'Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)', 'fullName': 'Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)'}"
