General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q9V535",
        "id": "RBM8A_DROME",
        "source_organism": {
            "taxId": "7227",
            "scientificName": "Drosophila melanogaster",
            "fullName": "Drosophila melanogaster (Fruit fly)"
        },
        "name": "RNA-binding protein 8A",
        "description": [
            "Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs (PubMed:14973490, PubMed:24967911). Involved in exon definition of genes containing long introns, including the rolled/MAPK gene (PubMed:20946982, PubMed:20946983). The mago-tsu heterodimer interacts with the EJC key regulator Pym leading to EJC disassembly in the cytoplasm (PubMed:24967911). Has a role in oskar mRNA localization to the posterior pole of the developing oocyte (PubMed:11691839)"
        ],
        "length": 165,
        "sequence": "MADVLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPKRVKKSEKRRR",
        "proteome": "UP000000803",
        "gene": "tsu",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003729",
                "name": "mRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0eb7dadcabd2c02a94f505008bf374cf6371f960",
        "counters": {
            "domain_architectures": 222038,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 4,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 222038
        }
    }
}