"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9V535"	"{'domain_architectures': 186638, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 4, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'profile': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 186638}"	"['Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs (PubMed:14973490, PubMed:24967911). Involved in exon definition of genes containing long introns, including the rolled/MAPK gene (PubMed:20946982, PubMed:20946983). The mago-tsu heterodimer interacts with the EJC key regulator Pym leading to EJC disassembly in the cytoplasm (PubMed:24967911). Has a role in oskar mRNA localization to the posterior pole of the developing oocyte (PubMed:11691839)']"	"tsu"	"[{'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003729', 'name': 'mRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006396', 'name': 'RNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005634', 'name': 'nucleus', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RBM8A_DROME"	"0eb7dadcabd2c02a94f505008bf374cf6371f960"	True	False	165	"RNA-binding protein 8A"	1	"UP000000803"	"MADVLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPKRVKKSEKRRR"	"reviewed"	"{'taxId': '7227', 'scientificName': 'Drosophila melanogaster', 'fullName': 'Drosophila melanogaster (Fruit fly)'}"