General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q8E280",
        "id": "RBSD_STRA5",
        "source_organism": {
            "taxId": "208435",
            "scientificName": "Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)",
            "fullName": "Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)"
        },
        "name": "D-ribose pyranase",
        "description": [
            "Catalyzes the interconversion of beta-pyran and beta-furan forms of D-ribose"
        ],
        "length": 132,
        "sequence": "MKKTGILNSHLAKLADDLGHTDRVCIGDLGLPVPNGIPKIDLSLTSGIPSFQEVLDIYLENILVEKVILAEEIKEANPDQLSRLLAKLDNSVSIEYVSHNHLKQMTQDVKAVIRTGENTPYSNIILQSGVII",
        "proteome": "UP000000821",
        "gene": "rbsD",
        "go_terms": [
            {
                "identifier": "GO:0016853",
                "name": "isomerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0048029",
                "name": "monosaccharide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005996",
                "name": "monosaccharide metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016872",
                "name": "intramolecular lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6a184bbcb997ae3df2edaad0b1b678abf8f0e5f5",
        "counters": {
            "domain_architectures": 11792,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11792
        }
    }
}