"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q8E280"	"{'domain_architectures': 7903, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7903}"	"['Catalyzes the interconversion of beta-pyran and beta-furan forms of D-ribose']"	"rbsD"	"[{'identifier': 'GO:0016853', 'name': 'isomerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0048029', 'name': 'monosaccharide binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005996', 'name': 'monosaccharide metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016872', 'name': 'intramolecular lyase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"RBSD_STRA5"	"6a184bbcb997ae3df2edaad0b1b678abf8f0e5f5"	True	False	132	"D-ribose pyranase"	3	"UP000000821"	"MKKTGILNSHLAKLADDLGHTDRVCIGDLGLPVPNGIPKIDLSLTSGIPSFQEVLDIYLENILVEKVILAEEIKEANPDQLSRLLAKLDNSVSIEYVSHNHLKQMTQDVKAVIRTGENTPYSNIILQSGVII"	"reviewed"	"{'taxId': '208435', 'scientificName': 'Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)', 'fullName': 'Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)'}"