GET /api/protein/reviewed/Q7BQ98/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q7BQ98",
"id": "STXB_SHIDY",
"source_organism": {
"taxId": "622",
"scientificName": "Shigella dysenteriae",
"fullName": "Shigella dysenteriae"
},
"name": "Shiga toxin subunit B",
"description": [
"The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli"
],
"length": 89,
"sequence": "MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR",
"proteome": null,
"gene": "stxB",
"go_terms": [
{
"identifier": "GO:0019836",
"name": "symbiont-mediated hemolysis of host erythrocyte",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "755d936a97862d33bf0e46daaeaccd52138a2ace",
"counters": {
"domain_architectures": 273,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 2,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"ncbifam": 2,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 273
}
}
}