General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q7BQ98",
        "id": "STXB_SHIDY",
        "source_organism": {
            "taxId": "622",
            "scientificName": "Shigella dysenteriae",
            "fullName": "Shigella dysenteriae"
        },
        "name": "Shiga toxin subunit B",
        "description": [
            "The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli"
        ],
        "length": 89,
        "sequence": "MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR",
        "proteome": null,
        "gene": "stxB",
        "go_terms": [
            {
                "identifier": "GO:0019836",
                "name": "symbiont-mediated hemolysis of host erythrocyte",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "755d936a97862d33bf0e46daaeaccd52138a2ace",
        "counters": {
            "domain_architectures": 273,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 2,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 2,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 273
        }
    }
}