"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q7BQ98"	"{'domain_architectures': 158, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 2, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'ncbifam': 2, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 158}"	"['The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli']"	"stxB"	"[{'identifier': 'GO:0019836', 'name': 'symbiont-mediated hemolysis of host erythrocyte', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"STXB_SHIDY"	"755d936a97862d33bf0e46daaeaccd52138a2ace"	True	False	89	"Shiga toxin subunit B"	1	""	"MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR"	"reviewed"	"{'taxId': '622', 'scientificName': 'Shigella dysenteriae', 'fullName': 'Shigella dysenteriae'}"