HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q6JLX1",
"id": "IGF1_AILME",
"source_organism": {
"taxId": "9646",
"scientificName": "Ailuropoda melanoleuca",
"fullName": "Ailuropoda melanoleuca (Giant panda)"
},
"name": "Insulin-like growth factor 1",
"description": [
"The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca(2+)-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (By similarity). As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM (By similarity)"
],
"length": 153,
"sequence": "MGKISSLPTQLFKCCFCDFLKVKMHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKAQKEVHLKNASRGSAGNKNYRM",
"proteome": "UP000008912",
"gene": "IGF1",
"go_terms": [
{
"identifier": "GO:0005179",
"name": "hormone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0008083",
"name": "growth factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005615",
"name": "extracellular space",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b9ca085d0992375b116a007d7162409be3587261",
"counters": {
"domain_architectures": 6728,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"smart": 1,
"panther": 1,
"prints": 3,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6728
}
}
}
