General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q6FSU2",
        "id": "GATF_CANGA",
        "source_organism": {
            "taxId": "284593",
            "scientificName": "Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)",
            "fullName": "Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) (Yeast)"
        },
        "name": "Glutamyl-tRNA(Gln) amidotransferase subunit F, mitochondrial",
        "description": [
            "Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). Required for proper protein synthesis within the mitochondrion"
        ],
        "length": 173,
        "sequence": "MSRFMIRAVFFRRYTAATVGKPFRNVAEVKQYLAKQTWSIDEILHGEDTGKAAKQGVPTEEEVRKLLALCAFPVEDADLQNSKRILVKQLSFINKLHETSVDDQDKNLDENYARLLPRQNKALTYDDLLKKIDGIKQDEATGEPTGSWDSTGLAKMRKDNYFIVRQGLLKNRK",
        "proteome": "UP000002428",
        "gene": "GTF1",
        "go_terms": [
            {
                "identifier": "GO:0050567",
                "name": "glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0070681",
                "name": "glutaminyl-tRNAGln biosynthesis via transamidation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005739",
                "name": "mitochondrion",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0030956",
                "name": "glutamyl-tRNA(Gln) amidotransferase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "16d1c902cc41ec9abb7e274b4ac84ba8e5c63d94",
        "counters": {
            "domain_architectures": 172,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 172
        }
    }
}